# Recombinant Mouse Ephrin B3 Protein (C-terminal Human Fc Tag)

**Cod produs:** A331569 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Ephrin B3 Protein (C-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331569, pentru ținta Ephrin-B3. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.830,13 și 2.462,35 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Ephrin-B3 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.01 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA |
| Activitate biologică | Immobilized Mouse EphB2(2 µg/mL) bind Mouse Efnb3 in a functional ELISA with a linear range of 0.50-58.76 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331569-20 · 1.830,13 lei |
| 50µg | A331569-50 · 2.462,35 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331569.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-ephrin-b3-protein-c-terminal-human-fc-tag/ · actualizat 9 septembrie 2026