# Recombinant Mouse EGF Protein

**Cod produs:** A330554 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse EGF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330554, pentru ținta EGF. Se livrează în mărimile 50µg și 100µg, la prețuri între 1.364,28 și 1.730,30 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | EGF |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | Pichia |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
| Activitate biologică | Inhibition of cell proliferation for BALB/3T3 mouse fibroblasts: ED50 = 37-148 pg/mL; Specific activity = 7.14×10^6~2.50×10^7 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330554-50 · 1.364,28 lei |
| 100µg | A330554-100 · 1.730,30 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330554.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-egf-protein-2/ · actualizat 9 septembrie 2026