# Recombinant Mouse CXCL1 Protein

**Cod produs:** A331544 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse CXCL1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331544, pentru ținta CXCL1. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | CXCL1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Pichia |
| Nature | Recombinant |
| Protein species | Mouse |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
| Activitate biologică | Immobilized Mouse CXCL1 (2µg/mL) bind GRO alpha Rabbit pAb in a functional ELISA with a linear range of 0.6-2.37 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331544-20 · 1.996,50 lei |
| 50µg | A331544-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331544.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-cxcl1-protein/ · actualizat 9 septembrie 2026
