# Recombinant Mouse C5 Protein

**Cod produs:** A331527 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse C5 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331527, pentru ținta C5. Se livrează în mărimea 100µg, la prețul de 4.891,43 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | C5 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | = 95% (by SDS-PAGE) and = 90% (by SEC-HPLC). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A331527-100 · 4.891,43 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331527.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-c5-protein-2/ · actualizat 9 septembrie 2026