# Recombinant Mouse Bax Protein

**Cod produs:** A60968 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Bax Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60968, pentru ținta Bax. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.963,23 și 42.392,35 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Bax |
| Applications | SDS-PAGE |
| Formulation | Supplied in 10 mM Tris HCl Buffer, pH 8, with 1 mM EDTA and 250 mM Sodium Chloride. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | MAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A60968-2 · 1.963,23 lei |
| 10µg | A60968-10 · 2.628,73 lei |
| 1mg | A60968-1 · 42.392,35 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60968.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-bax-protein/ · actualizat 9 septembrie 2026
