# Recombinant Mouse Bax Protein (GST Tag)

**Cod produs:** A59198 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Mouse Bax Protein (GST Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A59198, pentru ținta Bax. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.963,23 și 42.392,35 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Bax |
| Applications | SDS-PAGE |
| Formulation | Supplied in 10 mM Tris HCl Buffer, pH 8, with 1 mM EDTA, 150 mM Sodium Chloride, 0.1% Tween, 10 mM Glutathione, and 150 mM Sodium Chloride. |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Mouse |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles. |
| Secvență | MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQ |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A59198-2 · 1.963,23 lei |
| 10µg | A59198-10 · 2.628,73 lei |
| 1mg | A59198-1 · 42.392,35 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/59/A59198.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-mouse-bax-protein-gst-tag/ · actualizat 9 septembrie 2026
