# Recombinant Monkeypox Virus D6L Protein (C-Terminal 6x His Tag)

**Cod produs:** A329071 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Monkeypox Virus D6L Protein (C-Terminal 6x His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A329071, pentru ținta D6L. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.730,30 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | D6L |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a 0.22 µm filtered solution of Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Molecular weight | 15 - 20 kDa |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Monkeypox virus |
| Endotoxin level | <0.1 EU/µg. |
| Recovery | Abclonal |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C for up to 1 year. Reconstituted: Short term (1 week) at 2-8°C. Long term (3 months) at -20°C. |
| Secvență | VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK |
| Aminoacizi | 21-126 aa |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A329071-20 · 1.730,30 lei |
| 50µg | A329071-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329071.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-monkeypox-virus-d6l-protein-c-terminal-6x-his-tag/ · actualizat 9 septembrie 2026