# Recombinant Human VEGFD Protein (C-terminal His Tag)

**Cod produs:** A63277 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human VEGFD Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63277, pentru ținta VEGFD. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 41.460,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | VEGFD |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with sterile 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS |
| Activitate biologică | ED50: 3-4 ng/ml, as determined by its ability to stimulate the proliferation of human microvascular endothelial cells (HMVECs). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A63277-2 · 1.730,30 lei |
| 10µg | A63277-10 · 2.329,25 lei |
| 1mg | A63277-1 · 41.460,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63277.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-vegfd-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026