# Recombinant Human VEGFA Protein

**Cod produs:** A63066 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human VEGFA Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63066, pentru ținta VEGFA. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 59.096,40 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | VEGFA |
| Applications | Cell Proliferation Assay |
| Formulation | Lyophilized from a solution containing 50 mM Acetic acid. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Baculovirus infected Sf9 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 50 mM Acetic acid to a concentration, to no less than 50 µg/ml. |
| Protein Length | Protein fragment |
| Secvență | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR |
| Activitate biologică | ED50: 2-10 ng/ml, as determined in a cell proliferation assay using primary HUVECs. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A63066-2 · 1.730,30 lei |
| 10µg | A63066-10 · 2.329,25 lei |
| 1mg | A63066-1 · 59.096,40 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63066.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-vegfa-protein/ · actualizat 9 septembrie 2026