# Recombinant Human TL1A Protein

**Cod produs:** A63387 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TL1A Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63387, pentru ținta TL1A. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TL1A |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 0.02% Tween 20. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Activitate biologică | ED50: 5.0×104 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63387-5 · 1.730,30 lei |
| 20µg | A63387-20 · 2.329,25 lei |
| 1mg | A63387-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63387.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tl1a-protein/ · actualizat 9 septembrie 2026
