# Recombinant Human TL1A Protein

**Cod produs:** A331337 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TL1A Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331337, pentru ținta TL1A. Se livrează în mărimea 20µg, la prețul de 1.996,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TL1A |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris, pH 8.0, with 50mM NaCl and 5% Glycerol (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331337-20 · 1.996,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331337.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tl1a-protein-2/ · actualizat 9 septembrie 2026
