# Recombinant Human TIMP2 Protein (C-terminal His Tag)

**Cod produs:** A331334 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TIMP2 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331334, pentru ținta TIMP2. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.262,70 și 3.327,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TIMP2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
| Activitate biologică | Inhibition of human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2: IC50 = approximately 2.5 nM. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331334-20 · 2.262,70 lei |
| 50µg | A331334-50 · 3.327,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331334.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-timp2-protein-c-terminal-his-tag-3/ · actualizat 9 septembrie 2026