# Recombinant Human TIMP2 Protein (C-terminal His Tag)

**Cod produs:** A61959 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TIMP2 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61959, pentru ținta TIMP2. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 41.460,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TIMP2 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with Assay buffer (50 mM Tris, 10 mM Calcium Chloride, 150 mM Sodium Chloride, 0.05% Brij-35, pH 7.5), to no less than 0.1 mg/ml. |
| Protein Length | Protein fragment |
| Secvență | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
| Activitate biologică | IC50: of 3 nM, as determined its ability to inhibit recombinant human MMP-2 cleavage of the colorimetric peptide substrate, Mca-PLGL-DpaAR-NH2. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61959-2 · 1.730,30 lei |
| 10µg | A61959-10 · 2.329,25 lei |
| 1mg | A61959-1 · 41.460,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61959.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-timp2-protein-c-terminal-his-tag-2/ · actualizat 9 septembrie 2026