# Recombinant Human TIMP1 Protein (N-terminal His Tag)

**Cod produs:** A62414 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TIMP1 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A62414, pentru ținta TIMP1. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.963,23 și 24.623,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TIMP1 |
| Applications | SDS-PAGE |
| Formulation | Supplied at pH 4.8 with 25 mM Sodium Acetate and 50% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A62414-2 · 1.963,23 lei |
| 10µg | A62414-10 · 2.628,73 lei |
| 1mg | A62414-1 · 24.623,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/62/A62414.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-timp1-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026