# Recombinant Human Thioredoxin Protein (C-terminal His Tag)

**Cod produs:** A331321 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Thioredoxin Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331321, pentru ținta Thioredoxin. Se livrează în mărimea 20µg, la prețul de 1.197,90 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Thioredoxin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris, pH 8.0, with 150mM NaCl (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
| Activitate biologică | Immobilized Human TXN Protein (1 µg/mL) bind TXN Rabbit mAb in a functional ELISA with a linear range of 0.976-5.3 ng/mL. Catalysis of the reduction of insulin: Specific activity = >9 A650/min/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331321-20 · 1.197,90 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331321.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-thioredoxin-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026
