# Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag)

**Cod produs:** A331320 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331320, pentru ținta TGF beta Receptor II. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TGF beta Receptor II |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD |
| Activitate biologică | Immobilized recombinant human TGFB1 (2 µg/mL) bind recombinant human TGFBR2 in a functional ELISA with a linear range of 1-5 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331320-20 · 1.996,50 lei |
| 50µg | A331320-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331320.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tgf-beta-receptor-ii-protein-c-terminal-human-fc-and-his-tag/ · actualizat 9 septembrie 2026