# Recombinant Human TGF beta 3 Protein

**Cod produs:** A331317 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TGF beta 3 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331317, pentru ținta TGF beta 3. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.662,00 și 4.558,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TGF beta 3 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 50mM Glycine-HCl, pH 2.5, with 150mM NaCl (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Activitate biologică | Inhibition of the IL-4-dependent proliferation of HT-2 mouse T cells: ED50 = 24.2-96.6 pg/mL; Specific activity = 1.04×10^7~4.17×10^7 units/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331317-20 · 2.662,00 lei |
| 50µg | A331317-50 · 4.558,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331317.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tgf-beta-3-protein-4/ · actualizat 9 septembrie 2026