# Recombinant Human TGF beta 2 Protein (N-terminal His Tag)

**Cod produs:** A63344 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TGF beta 2 Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63344, pentru ținta TGF beta 2. Se livrează în mărimile 1µg, 5µg și 100µg, la prețuri între 1.730,30 și 14.108,60 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TGF beta 2 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 50 mM Tris HCl Buffer, pH 7.4. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >97% as determined by SDS-PAGE. |
| Expression system | Nicotiana benthamiana |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 25 ng/µl, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS |
| Activitate biologică | ED50: <40 ng/ml, as determined by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation, corresponding to a specific activity of 25,000 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 1µg | A63344-1 · 1.730,30 lei |
| 5µg | A63344-5 · 2.329,25 lei |
| 100µg | A63344-100 · 14.108,60 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63344.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tgf-beta-2-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026