# Recombinant Human TARC/CCL17 Protein

**Cod produs:** A61328 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human TARC/CCL17 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61328, pentru ținta TARC/CCL17. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TARC/CCL17 |
| Applications | Chemotaxis |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 500 µg/ml |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS |
| Activitate biologică | Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61328-5 · 1.730,30 lei |
| 20µg | A61328-20 · 2.329,25 lei |
| 1mg | A61328-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61328.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-tarc-ccl17-protein/ · actualizat 9 septembrie 2026