# Recombinant Human Sonic Hedgehog Protein

**Cod produs:** A331290 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Sonic Hedgehog Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331290, pentru ținta Sonic Hedgehog. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.996,50 și 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Sonic Hedgehog |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM Tris, pH 7.4, with 300mM NaCl and without preservatives or carriers (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Activitate biologică | Inhibition of p53 expression in C3H10T1/2 mouse embryonic fibroblast cells: 1.25-2.5µg/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331290-20 · 1.996,50 lei |
| 50µg | A331290-50 · 2.861,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331290.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-sonic-hedgehog-protein-3/ · actualizat 9 septembrie 2026