# Recombinant Human S100A9 Protein (C-terminal His Tag)

**Cod produs:** A331238 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human S100A9 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331238, pentru ținta S100A9. Se livrează în mărimea 50µg, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | S100A9 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 1mM DTT and without preservatives or carriers (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | Baculovirus infected Sf9 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Activitate biologică | Immobilized Human S100A9 Protein (2 µg/mL) bind AGER in a functional ELISA with a linear range of 0.124-41.19 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A331238-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331238.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-s100a9-protein-c-terminal-his-tag-2/ · actualizat 9 septembrie 2026