# Recombinant Human RSPO2 Protein (C-terminal Human Fc Tag)

**Cod produs:** A331230 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human RSPO2 Protein (C-terminal Human Fc Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331230, pentru ținta RSPO2. Se livrează în mărimile 10µg și 50µg, la prețuri între 1.996,50 și 4.625,23 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | RSPO2 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 90% (by SDS-PAGE) |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.01 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG |
| Activitate biologică | Ability to induce Topflash reporter activity in 293 human embryonic kidney cells: ED50 = 86ng/mL in the presence of 3.24ng/mL Recombinant Human Wnt3a Surrogate. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A331230-10 · 1.996,50 lei |
| 50µg | A331230-50 · 4.625,23 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331230.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-rspo2-protein-c-terminal-human-fc-tag/ · actualizat 9 septembrie 2026