# Recombinant Human Resistin Protein (N-terminal His Tag)

**Cod produs:** A61404 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Resistin Protein (N-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61404, pentru ținta Resistin. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.963,23 și 33.141,90 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Resistin |
| Applications | SDS-PAGE |
| Formulation | Supplied in 20 mM Tris HCl Buffer, pH 8, with 5 mM EDTA and 50% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61404-5 · 1.963,23 lei |
| 25µg | A61404-25 · 2.628,73 lei |
| 1mg | A61404-1 · 33.141,90 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61404.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-resistin-protein-n-terminal-his-tag/ · actualizat 9 septembrie 2026
