# Recombinant Human Rb Protein (C-terminal His Tag)

**Cod produs:** A60984 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Rb Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60984, pentru ținta Rb. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 16.637,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Rb |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A60984-10 · 1.730,30 lei |
| 50µg | A60984-50 · 2.329,25 lei |
| 1mg | A60984-1 · 16.637,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60984.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-rb-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026