# Recombinant Human PLA2R1 Protein (Functional)

**Cod produs:** A122164 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human PLA2R1 Protein (Functional) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A122164, pentru ținta PLA2R1. Se livrează în mărimile 10µg, 50µg și 100µg, la prețuri între 1.563,93 și 6.089,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PLA2R1 |
| Applications | WB, SDS-PAGE, Immunoassays, Functional Studies |
| Formulation | Supplied in Phosphate Buffered Saline with 20% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity-chromatography |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Protein species | Human |
| Protein Length | Protein fragment |
| Endotoxin level | < 0.1 ng/µg (1 IEU/µg), as measured by LAL method. |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -70°C. Avoid freeze/thaw cycles. |
| Secvență | AEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTGSGHHHHHHHHHHRRKR |
| Aminoacizi | 21 to 173 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A122164-10 · 1.563,93 lei |
| 50µg | A122164-50 · 3.593,70 lei |
| 100µg | A122164-100 · 6.089,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/122/A122164.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-pla2r1-protein-functional-4/ · actualizat 9 septembrie 2026
