# Recombinant Human PLA2G1B Protein (C-terminal His Tag)

**Cod produs:** A331176 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human PLA2G1B Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331176, pentru ținta PLA2G1B. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.861,65 și 4.192,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PLA2G1B |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 10mM Tris, pH 8.0, with 5mM CaCl2 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >92% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS |
| Activitate biologică | Hydrolysis of 1-Hexadecanoyl-2-(1-pyrenedecanoyl)-sn-glycero-3-phosphomethanol: Specific activity = >2500 pmol/min/µg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331176-20 · 2.861,65 lei |
| 50µg | A331176-50 · 4.192,65 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331176.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-pla2g1b-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026