# Recombinant Human PIN1 Protein

**Cod produs:** A331175 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human PIN1 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331175, pentru ținta Pin1. Se livrează în mărimea 20µg, la prețul de 1.896,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Pin1 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
| Activitate biologică | Immobilized Human CTNNB1 Protein (2 µg/mL) bind PIN1 in a functional ELISA with a linear range of 7.8-164.3 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331175-20 · 1.896,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331175.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-pin1-protein-2/ · actualizat 9 septembrie 2026