# Recombinant Human PDGF AA Protein

**Cod produs:** A331149 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human PDGF AA Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331149, pentru ținta PDGF AA. Se livrează în mărimile 20µg și 50µg, la prețuri între 2.262,70 și 3.327,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PDGF AA |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 20mM NaAc, pH 4.5 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Expression system | Pichia |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331149-20 · 2.262,70 lei |
| 50µg | A331149-50 · 3.327,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331149.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-pdgf-aa-protein-3/ · actualizat 9 septembrie 2026