# Recombinant Human Parathyroid Hormone Protein

**Cod produs:** A63468 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Parathyroid Hormone Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63468, pentru ținta Parathyroid Hormone. Se livrează în mărimile 100µg, 500µg și 1mg, la prețuri între 2.994,75 și 8.119,10 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Parathyroid Hormone |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 1.15 mg Sodium Citrate, 7.31 mg Sodium Chloride, 0.21 mg Citric Acid, 0.1117 EDTA-Na2, 0.2 mg Tween 80, and 50 mg Mannitol. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Activitate biologică | The activity calculated by UMR106 cell/cAMP method corresponding to a specific activity of 10,000 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A63468-100 · 2.994,75 lei |
| 500µg | A63468-500 · 5.523,65 lei |
| 1mg | A63468-1 · 8.119,10 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63468.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-parathyroid-hormone-protein-4/ · actualizat 9 septembrie 2026