# Recombinant Human NRG1 Type II Protein

**Cod produs:** A63582 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human NRG1 Type II Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63582, pentru ținta NRG1 Type II. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 12.744,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NRG1 Type II |
| Applications | Cell Proliferation Assay |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >96% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ |
| Activitate biologică | ED50: 2.0 x 10^5 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A63582-10 · 1.730,30 lei |
| 50µg | A63582-50 · 2.329,25 lei |
| 1mg | A63582-1 · 12.744,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63582.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-nrg1-type-ii-protein/ · actualizat 9 septembrie 2026