# Recombinant Human NKp30 Protein (C-terminal Human Fc and His Tag)

**Cod produs:** A331110 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human NKp30 Protein (C-terminal Human Fc and His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A331110, pentru ținta NKp30. Se livrează în mărimile 20µg și 50µg, la prețuri între 1.896,68 și 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NKp30 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT |
| Activitate biologică | Immobilized recombinant Human B7-H6 (2 µg/mL) bind recombinant Human NCR3 in a functional ELISA: EC50 = 66.43 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A331110-20 · 1.896,68 lei |
| 50µg | A331110-50 · 2.662,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/331/A331110.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-nkp30-protein-c-terminal-human-fc-and-his-tag/ · actualizat 9 septembrie 2026
