# Recombinant Human NGF Protein

**Cod produs:** A63548 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human NGF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63548, pentru ținta NGF. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NGF |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7, with 250 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | CHO cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR |
| Aminoacizi | 2 x 118 |
| Activitate biologică | ED50: 1 x 106 U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63548-5 · 1.730,30 lei |
| 20µg | A63548-20 · 2.329,25 lei |
| 1mg | A63548-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63548.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ngf-protein-2/ · actualizat 9 septembrie 2026