# Recombinant Human NF-L Polypeptide

**Cod produs:** A270596 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human NF-L Polypeptide este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A270596, pentru ținta NF-L. Se livrează în mărimile 25µg și 50µg, la prețuri între 4.225,93 și 6.921,20 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NF-L |
| Applications | ELISA, MSD, Luminex, Simoa assays |
| Formulation | Supplied in 10 mM Phosphate Buffer, pH 7.5, with 6 M Urea. |
| Product form | Liquid |
| Concentration | 0.5 mg/ml |
| Purification | Immobilized metal ion affinity chromatography. |
| Molecular weight | 23 kDa (by SDS-PAGE) |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRL |
| Aminoacizi | 256-400 aa. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 25µg | A270596-25 · 4.225,93 lei |
| 50µg | A270596-50 · 6.921,20 lei |

## Descriere

This recombinant protein can be used as a protein standard for ELISA and other assays, and as an immunogen for antibody production.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/270/A270596.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-nf-l-polypeptide/ · actualizat 9 septembrie 2026