# Recombinant Human Myelin Oligodendrocyte Glycoprotein (C-terminal His Tag)

**Cod produs:** A60971 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Myelin Oligodendrocyte Glycoprotein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A60971, pentru ținta Myelin Oligodendrocyte Glycoprotein. Se livrează în mărimile 10µg, 50µg și 1mg, la prețuri între 1.730,30 și 14.108,60 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Myelin Oligodendrocyte Glycoprotein |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Acetic acid-Sodium Acetate Buffer, pH 4.5, with 150 mM Sodium chloride. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 50 mM Acetic acid to a concentration, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 10µg | A60971-10 · 1.730,30 lei |
| 50µg | A60971-50 · 2.329,25 lei |
| 1mg | A60971-1 · 14.108,60 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/60/A60971.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-myelin-oligodendrocyte-glycoprotein-c-terminal-his-tag/ · actualizat 9 septembrie 2026