# Recombinant Human MIF Protein

**Cod produs:** A63150 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human MIF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63150, pentru ținta MIF. Se livrează în mărimile 3 x 2µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | MIF |
| Applications | ELISA |
| Formulation | Lyophilized from 10 mM Phosphate Buffered Saline, pH 7.5. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water at a concentration between 0.1-1 mg per 1 ml. |
| Protein Length | Full length protein. |
| Secvență | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Activitate biologică | ED50: 88-132 ng/ml, as determined by human PBMCs cultured with 0 to 1000 ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 3 x 2µg | A63150-32 · 1.730,30 lei |
| 25µg | A63150-25 · 1.963,23 lei |
| 1mg | A63150-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63150.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-mif-protein/ · actualizat 9 septembrie 2026