# Recombinant Human Melanoma Inhibitory Activity Protein

**Cod produs:** A63417 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Melanoma Inhibitory Activity Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63417, pentru ținta Melanoma Inhibitory Activity. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 31.211,95 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Melanoma Inhibitory Activity |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 20 mM Potassium Phosphate and 150 mM Potassium Chloride, pH 7. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ |
| Activitate biologică | The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63417-5 · 1.730,30 lei |
| 20µg | A63417-20 · 2.329,25 lei |
| 1mg | A63417-1 · 31.211,95 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63417.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-melanoma-inhibitory-activity-protein/ · actualizat 9 septembrie 2026