# Recombinant Human Macrophage Inflammatory Protein 5

**Cod produs:** A61294 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Macrophage Inflammatory Protein 5 este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61294, pentru ținta Macrophage Inflammatory Protein 5. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Macrophage Inflammatory Protein 5 |
| Applications | Chemotaxis |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 100 mM Sodium Chloride. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Activitate biologică | Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61294-5 · 1.730,30 lei |
| 25µg | A61294-25 · 2.329,25 lei |
| 1mg | A61294-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61294.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-macrophage-inflammatory-protein-5-2/ · actualizat 9 septembrie 2026