# Recombinant Human LIF Protein

**Cod produs:** A61463 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human LIF Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61463, pentru ținta LIF. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 31.944,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | LIF |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >98% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Pichia pastoris |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61463-5 · 1.730,30 lei |
| 25µg | A61463-25 · 2.329,25 lei |
| 1mg | A61463-1 · 31.944,00 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61463.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-lif-protein/ · actualizat 9 septembrie 2026
