# Recombinant Human Leptin Protein (His Tag)

**Cod produs:** A63138 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Leptin Protein (His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63138, pentru ținta Leptin. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 21.761,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Applications | WB, Antibody Production, Protein Assay |
| Formulation | Lyophilized from Phosphate Buffered Saline with 0.1% SDS and 1 mM DTT. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >90% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with water or aqueous buffers. Very soluble in water and most aqueous buffers below and above the isoelectric point. |
| Protein Length | Protein fragment |
| Storage | Shipped at ambient temperature. Lyophilized: Short term store at 25°C. Long term store desiccated below 0°C. Reconstituted: Store at 4°C. Avoid freeze/thaw cycles. |
| Secvență | TQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63138-5 · 1.730,30 lei |
| 25µg | A63138-25 · 2.329,25 lei |
| 1mg | A63138-1 · 21.761,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63138.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-leptin-protein-his-tag/ · actualizat 9 septembrie 2026