# Recombinant Human Leptin Protein

**Cod produs:** A330995 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Leptin Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330995, pentru ținta Leptin. Se livrează în mărimea 50µg, la prețul de 1.364,28 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from 50mM Tris, pH 8.0, with 150mM NaCl and without preservatives or carriers (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >92% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Activitate biologică | Immobilized Recombinant Human Leptin (2 µg/mL) bind Recombinant Human Leptin R/CD295 in a functional ELISA with a linear range of 1.22-261.45 ng/mL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330995-50 · 1.364,28 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330995.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-leptin-protein-3/ · actualizat 9 septembrie 2026