# Recombinant Human IP10 Protein

**Cod produs:** A61313 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IP10 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61313, pentru ținta IP10. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IP10 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from a solution containing 0.1% TFA. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61313-5 · 1.730,30 lei |
| 25µg | A61313-25 · 2.329,25 lei |
| 1mg | A61313-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61313.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-ip10-protein/ · actualizat 9 septembrie 2026