# Recombinant Human Interferon-alpha Protein (C-terminal His Tag)

**Cod produs:** A330950 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Interferon-alpha Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330950, pentru ținta Interferon alpha. Se livrează în mărimile 50µg și 100µg, la prețuri între 2.662,00 și 3.760,08 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Interferon alpha |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
| Activitate biologică | Stimulation of GBP2 expression in 293T human embryonic kidney cells: 0.1-1ng/mL. Stimulation of human colon adenocarcinoma cells (Caco-2 cells): 10 ng/µL. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330950-50 · 2.662,00 lei |
| 100µg | A330950-100 · 3.760,08 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330950.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-interferon-alpha-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026