# Recombinant Human Interferon alpha 2 Protein

**Cod produs:** A61560 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human Interferon alpha 2 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61560, pentru ținta Interferon alpha 2. Se livrează în mărimile 20µg, 100µg și 1mg, la prețuri între 1.730,30 și 8.984,25 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Interferon alpha 2 |
| Applications | Viral Resistance Assay |
| Formulation | Lyophilized without additives. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Activitate biologică | The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 20µg | A61560-20 · 1.730,30 lei |
| 100µg | A61560-100 · 2.329,25 lei |
| 1mg | A61560-1 · 8.984,25 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61560.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-interferon-alpha-2-protein/ · actualizat 9 septembrie 2026