# Recombinant Human IL37 Protein

**Cod produs:** A330903 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IL37 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330903, pentru ținta IL37. Se livrează în mărimea 50µg, la prețul de 4.558,68 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL37 |
| Conjugate | Unconjugated |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.2µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95% (by SDS-PAGE). |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with distilled sterile water to a concentration of 0.1-0.5 mg/mL. |
| Endotoxin level | <0.1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | NLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 50µg | A330903-50 · 4.558,68 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330903.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-il37-protein-2/ · actualizat 9 septembrie 2026