# Recombinant Human IL-36RN Protein

**Cod produs:** A61615 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IL-36RN Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61615, pentru ținta IL-36RN. Se livrează în mărimile 5µg, 25µg și 1mg, la prețuri între 1.730,30 și 24.423,85 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-36RN |
| Applications | ELISA |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >95% as determined by RP-HPLC and SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Centrifuge vial before opening. Reconstitute with Phosphate Buffered Saline to a concentration, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Full length protein. |
| Secvență | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Activitate biologică | As measured by its binding ability in a functional ELISA, immobilized IL1F5 at 1 µg/ml (100 µl/well) can bind rHuIL-1 Rrp2/Fc Chimera with a linear range of 0.15- 5 µg/ml. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A61615-5 · 1.730,30 lei |
| 25µg | A61615-25 · 2.329,25 lei |
| 1mg | A61615-1 · 24.423,85 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61615.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-il-36rn-protein/ · actualizat 9 septembrie 2026