# Recombinant Human IL-33 Protein (C-terminal His Tag)

**Cod produs:** A61486 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IL-33 Protein (C-terminal His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61486, pentru ținta IL-33. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.963,23 și 42.392,35 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-33 |
| Applications | SDS-PAGE |
| Formulation | Supplied in 10 mM Tris HCl Buffer, pH 8, with 180 mM Sodium Chloride and 50% Glycerol. |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purity | >90% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Protein Length | Protein fragment |
| Storage | Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles. |
| Secvență | SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61486-2 · 1.963,23 lei |
| 10µg | A61486-10 · 2.628,73 lei |
| 1mg | A61486-1 · 42.392,35 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61486.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-il-33-protein-c-terminal-his-tag/ · actualizat 9 septembrie 2026