# Recombinant Human IL-15RA Protein (Biotin) (C-terminal His and Avi Tag)

**Cod produs:** A330823 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IL-15RA Protein (Biotin) (C-terminal His and Avi Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A330823, pentru ținta IL-15RA. Se livrează în mărimea 100µg, la prețul de 5.590,20 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-15RA |
| Conjugate | Biotin |
| Formulation | Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized). |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | > 95 % by SDS-PAGE and HPLC |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Endotoxin level | <1 EU/µg of the protein by LAL method. |
| Storage | Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles. |
| Secvență | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A330823-100 · 5.590,20 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/330/A330823.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-il-15ra-protein-biotin-c-terminal-his-and-avi-tag/ · actualizat 9 septembrie 2026
