# Recombinant Human IL-1 beta Protein

**Cod produs:** A61383 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IL-1 beta Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A61383, pentru ținta IL-1 beta. Se livrează în mărimile 2µg, 10µg și 1mg, la prețuri între 1.730,30 și 50.012,33 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IL-1 beta |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >95% as determined by SDS-PAGE. |
| Expression system | HEK293 cells |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with Phosphate Buffered Saline containing 0.1% endotoxin-free recombinant HSA. |
| Secvență | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Activitate biologică | The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08 ng/ml. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 2µg | A61383-2 · 1.730,30 lei |
| 10µg | A61383-10 · 2.329,25 lei |
| 1mg | A61383-1 · 50.012,33 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/61/A61383.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-il-1-beta-protein/ · actualizat 9 septembrie 2026