# Recombinant Human IGFBP6 Protein (His Tag)

**Cod produs:** A63247 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IGFBP6 Protein (His Tag) este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63247, pentru ținta IGFBP6. Se livrează în mărimile 5µg, 20µg și 1mg, la prețuri între 1.730,30 și 21.961,50 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IGFBP6 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from Phosphate Buffered Saline with 0.1% SDS and 1 mM DTT. |
| Product form | Lyophilized |
| Concentration | 1 mg/ml |
| Purity | >80% as determined by SDS-PAGE. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water, to no less than 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Protein Length | Protein fragment |
| Secvență | SQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 5µg | A63247-5 · 1.730,30 lei |
| 20µg | A63247-20 · 2.329,25 lei |
| 1mg | A63247-1 · 21.961,50 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63247.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-igfbp6-protein-his-tag/ · actualizat 9 septembrie 2026
