# Recombinant Human IGF-I LR3 Protein

**Cod produs:** A63220 · **Brand:** Antibodies · **Categorie:** Peptide și proteine

Recombinant Human IGF-I LR3 Protein este o proteină sau peptidă de laborator din categoria Peptide și proteine, marca Antibodies, cod A63220, pentru ținta IGF-I LR3. Se livrează în mărimile 200µg, 500µg și 1mg, la prețuri între 1.730,30 și 2.828,38 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | IGF-I LR3 |
| Applications | SDS-PAGE |
| Formulation | Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.2. |
| Product form | Lyophilized |
| Concentration | Reconstitution dependent. |
| Purity | >97% as determined by SDS-PAGE and HPLC. |
| Expression system | Escherichia coli |
| Nature | Recombinant |
| Protein species | Human |
| Reconstitution | Reconstitute with 18 MO-cm water to 0.1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Secvență | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA |
| Activitate biologică | ED50: <10 ng/ml, as determined by the stimulation of protein synthesis in L6 myoblasts, corresponding to a specific activity of 100,000U/mg. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 200µg | A63220-200 · 1.730,30 lei |
| 500µg | A63220-500 · 2.229,43 lei |
| 1mg | A63220-1 · 2.828,38 lei |

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/63/A63220.pdf)

---

Sursă: https://reactivi.ro/produs/recombinant-human-igf-i-lr3-protein/ · actualizat 9 septembrie 2026
